missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Importin 11 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17196-25UL
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
Importin 11 Polyclonal antibody specifically detects Importin 11 in Human samples. It is validated for Immunofluorescence
Specifikationer
| Importin 11 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| imp11, importin 11, Ran binding protein 11, Ran-binding protein 11, RANBP11, RanBP11importin-11, SLRN | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AHKIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGDSWKYSLRPCTEVLFIDIFHEYNQ | |
| 25 μg | |
| Signal Transduction | |
| 51194 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering