missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
ISX Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79216-100UL
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
ISX Polyclonal specifically detects ISX in Human samples. It is validated for Western Blot.
Specifikationer
| ISX | |
| Polyclonal | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| intestine-specific homeobox, RAXLX | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 91464 | |
| Human | |
| IgG |
| Western Blot | |
| LYOPH | |
| Western Blot 1:1000 | |
| NP_001008494 | |
| ISX | |
| Synthetic peptide directed towards the N terminal of human ISXThe immunogen for this antibody is ISX. Peptide sequence ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV. | |
| 100 μL | |
| Primary | |
| Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
| Store at -20C. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
RUO
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering