missing translation for 'onlineSavingsMsg'
Läs mer

Abnova™ JAG1 (Human) Recombinant Protein (Q01)

Produktkod. 16013605
Klicka för att se tillgängliga alternativ
Kvantitet:
10 μg
25 μg
Förpackningsstorlek:
10µg
25µg
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 16013605

Brand: Abnova™ H00000182Q01.25ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Human JAG1 partial ORF with GST-tag at N-terminal

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

  • Theoretical MW: 35.64kDa
  • Preparation Method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifikationer

Tillträdesnummer NP_000205
För användning med (applikation) Antibody Production, ELISA, Protein Array, Western Blot
Formulering 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-ID (Entrez) 182
Molekylvikt (g/mol) 35.64
Namn JAG1 (Human) Recombinant Protein (Q01)
pH-intervall 8
Beredningsmetod In vitro wheat germ expression system
Reningsmetod Glutathione Sepharose 4 Fast Flow
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Kvantitet 25 μg
Källa Wheat Germ (in vitro)
Immunogen PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias AGS/AHD/AWS/CD339/HJ1/JAGL1/MGC104644
Vanligt namn JAG1
Gensymbol JAG1
Korsreaktivitet Human
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Protein Tag GST
Form Solution
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.