missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ JAG1 (Human) Recombinant Protein (Q01)
Human JAG1 partial ORF with GST-tag at N-terminal
Brand: Abnova™ H00000182-Q01.25ug
Additional Details : Weight : 0.02000kg
Description
The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.
- Theoretical MW: 35.64kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
| NP_000205 | |
| Solution | |
| 182 | |
| JAG1 (Human) Recombinant Protein (Q01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| JAG1 | |
| Human | |
| Yes |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 35.64 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG | |
| AGS/AHD/AWS/CD339/HJ1/JAGL1/MGC104644 | |
| JAG1 | |
| Wheat Germ (in vitro) | |
| GST |