missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ KCNG1 (Human) Recombinant Protein

Human KCNG1 full-length ORF ( AAH06367, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00003755-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16177091

  • 5030.41 SEK / 25µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPEDRRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMVEREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVTAVNLSVSTLPSLREEEEQVRAHAPRGNAPPRGKGL
Specifications

Specifications

AAH06367
potassium voltage-gated channel, subfamily G, member 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KCNG1
GST
3755
Wheat germ expression system
25 μg
K13, KCNG, KV6.1, MGC12878, kH2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates