missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. p14ARF/CDKN2A Antibody, R&D Systems™

p14ARF/CDKN2A Antibody, R&D Systems™

Product Code. 18621319 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18621319 25 μg 25µL
18635268 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18621319 Supplier Novus Biologicals Supplier No. NBP30552125ul
 Restricted Item
Beräknad leverans: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

p14ARF/CDKN2A Polyclonal specifically detects p14ARF/CDKN2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen p14ARF/CDKN2A
Applications Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Alias ARF, CDK4 inhibitor p16-INK4, CDK4IP14ARF, CDKN2, cell cycle negative regulator beta, CMM2P16-INK4A, Cyclin-dependent kinase 4 inhibitor A, cyclin-dependent kinase inhibitor 2A, cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), INK4, INK4A, MLMP16INK4, MTS-1, MTS1P14, Multiple tumor suppressor 1, p14, p14ARF, p16, p16-INK4, p16INK4a, p16-INK4a, P19, p19ARF, TP16
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline ABC Transporters, Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, Hypoxia, MAP Kinase Signaling, Neuroscience, p53 Pathway, Transcription Factors and Regulators, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 1029
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.