missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. Laminin beta 1 Antibody (CL2970), R&D Systems™

Laminin beta 1 Antibody (CL2970), R&D Systems™

Produktkod. 18603289 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18603289 0.1 mL
18655937 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18603289 Leverantör Novus Biologicals Leverantörsnummer NBP242385
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Laminin beta 1 Monoclonal antibody specifically detects Laminin beta 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Laminin beta 1
Användningsområden Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassificering Monoclonal
Klona CL2970
Konjugera Unconjugated
Utspädning Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulering PBS (pH 7.2), 40% Glycerol
Genaccessionsnr. P07942
Gene Alias CLM, cutis laxa with marfanoid phenotype, Laminin B1 chain, laminin subunit beta-1, laminin, beta 1, Laminin-1 subunit beta, Laminin-10 subunit beta, Laminin-12 subunit beta, Laminin-2 subunit beta, Laminin-6 subunit beta, Laminin-8 subunit beta, MGC142015
Värd art Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
Reningsmetod Protein A purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors
Primär eller sekundär Primary
Gen-ID (Entrez) 3912
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG1
Produktlinje Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.