missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
LIAT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-85208-0.1ML
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
LIAT1 Polyclonal specifically detects LIAT1 in Human samples. It is validated for Western Blot.
Specifikationer
| LIAT1 | |
| Polyclonal | |
| PBS, 2% Sucrose | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 400566 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| chromosome 17 open reading frame 97, hypothetical protein LOC400566 | |
| The immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering