missing translation for 'onlineSavingsMsg'
Learn More

LTBP1 (Human) Recombinant Protein (Q01), Abnova

Human LTBP1 partial ORF recombinant protein with GST-tag at N-terminal

Brand:  Abnova H00004052-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137471

  • 3343.96 SEK / 10µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Theoretical M.W.: 36.52kDa
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifications

Specifications

NP_000618
Solution
4052
LTBP1 (Human) Recombinant Protein (Q01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LTBP1
Human
Yes
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
36.52
8
Glutathione Sepharose 4 Fast Flow
10 ug
CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS
MGC163161
LTBP1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates