missing translation for 'onlineSavingsMsg'
Läs mer

Novus Biologicals™ Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen

Produktkod. 18294194 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18294194 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18294194 Leverantör Novus Biologicals™ Leverantörsnummer NBP257484PEP

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C. Source: E.coli Amino Acid Sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen is derived from E. coli. The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 23081
Reningsmetod >80% by SDS-PAGE and Coomassie blue staining
Vanligt namn Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen
Innehåll och lagring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA
Gensymbol KDM4C
Etiketttyp Unlabeled
Produkttyp Recombinant Protein Antigen
Kvantitet 100 μl
Regulatorisk status RUO
Källa E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For Research Use Only.

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.