missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18077278

Novus Biologicals™ Lysine-rich coiled-coil 1 Recombinant Protein Antigen

Produktkod. 18077278 Handla allt Bio Techne Produkter
Change view
Click to view available options
Kvantitet:
0,1 ml
Unit Size:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Kvantitet unitSize
18077278 0,1 ml 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18077278 Supplier Novus Biologicals™ Supplier No. NBP192092PEP

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KRCC1. The Lysine-rich coiled-coil 1 Recombinant Protein Antigen is derived from E. coli. The Lysine-rich coiled-coil 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-92092. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gen-ID (Entrez) 51315
Art Human
Reningsmetod Chromatography
Renhet >80%
Koncentration 0.5mg/mL
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gensymbol KRCC1
Etiketttyp Unlabeled
Molekylvikt (g/mol) 26kDa
Produkttyp Lysine-rich coiled-coil 1
Kvantitet 0,1 ml
Regulatorisk status RUO
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92092. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen CFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLS
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.