missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Invitrogen™ MAOB Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA579624
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HCCT tissue, human HCCP tissue, rat liver tissue, mouse liver tissue. IHC: human liver cancer tissue, mouse liver tissue, rat liver tissue.
MAOB (Monoamine Oxidase B), also called MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.
Specifikationer
| MAOB | |
| Polyclonal | |
| Unconjugated | |
| MAOB | |
| 6330414K01Rik; adrenalin oxidase; amine oxidase [flavin-containing] B; HGNC:6834; MAO b; MAO, brain; MAO, platelet; Maob; MAO-B; MGC26382; monoamine oxidase B; monoamine oxidase type B; monoamine oxidase-B; RP1-201D17__B.1; tyramine oxidase | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 109731, 25750, 4129 | |
| -20°C | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| 500 μg/mL | |
| PBS with 4mg trehalose and no preservative | |
| P19643, P27338, Q8BW75 | |
| MAOB | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering