missing translation for 'onlineSavingsMsg'
Läs mer

Novus Biologicals™ MARCKS Recombinant Protein Antigen

Produktkod. 18279252 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18279252 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18279252 Leverantör Novus Biologicals™ Leverantörsnummer NBP258267PEP

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MARCKS. Source: E.coli Amino Acid Sequence: MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ The MARCKS Recombinant Protein Antigen is derived from E. coli. The MARCKS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 4082
Reningsmetod >80% by SDS-PAGE and Coomassie blue staining
Vanligt namn MARCKS Recombinant Protein Antigen
Innehåll och lagring Store at −20C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias 80K-L, 80K-L protein, FLJ14368, MACSmyristoylated alanine-rich C-kinase substrate, MRACKS, myristoylated alanine-rich protein kinase C substrate, myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L), phosphomyristin, PKCSLFLJ90045, PRKCSL
Gensymbol MARCKS
Etiketttyp Unlabeled
Produkttyp Recombinant Protein Antigen
Kvantitet 100 μl
Regulatorisk status RUO
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51963. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.