missing translation for 'onlineSavingsMsg'
Learn More

MBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10344-100UL

Product Code. 18332385

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

MBD4 Polyclonal specifically detects MBD4 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

Antigen	MBD4
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Gene Alias	EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MBD4 (NP_003916). Peptide sequence CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
Quantity	100 μg
Research Discipline	Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics
Gene ID (Entrez)	8930
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description