missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. MED9 Antibody, R&D Systems™

MED9 Antibody, R&D Systems™

Produktkod. 18120484 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18120484 0.1 mL 0.1ml
18457391 25 μL -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18120484 Leverantör Novus Biologicals Leverantörsnummer NBP231639
  • ONLINE EXCLUSIVE PRICE
    6067.01 SEK
    5634.30 SEK / 0.1ml
    Save 432.71 SEK
    7% Av
 Begränsad artikel
Beräknad leverans: 02-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MED9 Polyclonal specifically detects MED9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).

TRUSTED_SUSTAINABILITY

Specifikationer

Antigen MED9
Användningsområden Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genaccessionsnr. Q9NWA0
Gene Alias FLJ10193mediator of RNA polymerase II transcription, subunit 9 homolog, MED25mediator of RNA polymerase II transcription subunit 9, mediator complex subunit 9MGC138234, mediator of RNA polymerase II transcription, subunit 9 homolog (S. cerevisiae), mediator subunit 25
Gensymboler MED9
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
Reningsmetod Affinity Purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 55090
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.