missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
MEKK1 Antibody (2F6), Alexa Fluor™ 350, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-47810AF350
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
MEKK1 Monoclonal specifically detects MEKK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| MEKK1 | |
| Monoclonal | |
| Alexa Fluor 350 | |
| 50 mM sodium borate with 0.05% sodium azide | |
| MAP3K1 | |
| Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233) | |
| 0.1 mL | |
| Primary | |
| Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination. | |
| Store at 4°C in the dark. |
| Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| 2F6 | |
| Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence | |
| Map3k1, MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1 | |
| Mouse | |
| Protein A or G purified | |
| Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Phospho Specific, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
| 4214.0 | |
| Human | |
| IgG2a κ |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering