missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18068878

Novus Biologicals™ Methionine Aminopeptidase 1D/MAP1D Recombinant Protein Antigen

Produktkod. 18068878 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0,1 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18068878 0,1 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18068878 Leverantör Novus Biologicals™ Leverantörsnummer NBP192098PEP
 Begränsad artikel
Beräknad leverans: 14-10-2026
Lägg i varukorgen
Lägg i varukorgen
Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human METAP1D. The Methionine Aminopeptidase 1D/MAP1D Recombinant Protein Antigen is derived from E. coli. The Methionine Aminopeptidase 1D/MAP1D Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-92098. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 254042
Art Human
Reningsmetod Chromatography
Renhet >80%
Koncentration 0.5mg/mL
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gensymbol METAP1D
Etiketttyp Unlabeled
Molekylvikt (g/mol) 26kDa
Produkttyp Methionine Aminopeptidase 1D/MAP1D
Kvantitet 0,1 ml
Regulatorisk status RUO
Forskningskategori Immunology
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92098. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen KPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGG
Visa mer Visa mindre

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.