missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Novus Biologicals™ Methionine Sulfoxide Reductase B Recombinant Protein Antigen
Handla allt Bio Techne ProdukterBeskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Methionine Sulfoxide Reductase B. Source: E.coli Amino Acid Sequence: LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP The Methionine Sulfoxide Reductase B Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifikationer
Specifikationer
| Gen-ID (Entrez) | 51734 |
| Reningsmetod | >80% by SDS-PAGE and Coomassie blue staining |
| Vanligt namn | Methionine Sulfoxide Reductase B Recombinant Protein Antigen |
| Innehåll och lagring | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| För användning med (applikation) | Blocking/Neutralizing, Control |
| Gene Alias | EC 1.8.4.-, methionine sulfoxide reductase, methionine-R-sulfoxide reductase B1, MGC3344, MsrB1, MSRB1selenoprotein R, Selenoprotein X, selenoprotein X, 1, SELR, SelX |
| Gensymbol | MSRB1 |
| Etiketttyp | Unlabeled |
| Produkttyp | Recombinant Protein Antigen |
| Visa mer |
For Research Use Only.
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?