missing translation for 'onlineSavingsMsg'
Läs mer

Novus Biologicals™ MMS22L Recombinant Protein Antigen

Produktkod. 18275464 Handla allt Bio Techne Produkter
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 18275464

Brand: Novus Biologicals™ NBP257743PEP

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMS22L. Source: E.coli Amino Acid Sequence: MSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRC The MMS22L Recombinant Protein Antigen is derived from E. coli. The MMS22L Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 253714
Reningsmetod >80% by SDS-PAGE and Coomassie blue staining
Vanligt namn MMS22L Recombinant Protein Antigen
Innehåll och lagring Store at −20°C. Avoid freeze-thaw cycles
Formulering PBS and 1M Urea, pH 7.4
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias C6orf167, Chromosome 6 Open Reading Frame 167, DJ39B17.2, Methyl Methanesulfonate-Sensitivity Protein 22-Like, MMS22 Like, DNA Repair Protein MMS22-Like, DNA Repair Protein, Protein MMS22-Like
Gensymbol MMS22L
Etiketttyp Unlabeled
Produkttyp Recombinant Protein Antigen
Kvantitet 100 μL
Regulatorisk status RUO
Källa E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52989. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For research use only.

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.