missing translation for 'onlineSavingsMsg'
Learn More

HAPLN4, Mouse, Polyclonal Antibody, Abnova™

Name: HAPLN4, Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16162977
Price: 3050.00 EUR

Mouse polyclonal antibody raised against a partial recombinant HAPLN4.

Brand: Abnova H00404037-A01.50uL

Additional Details : Weight : 0.00010kg

Product Code. 16162977

Estimated Shipment: 29-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT

Specifications

Antigen	HAPLN4
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant HAPLN4.
Gene	HAPLN4
Gene Alias	BRAL2/KIAA1926
Host Species	Mouse
Quantity	50 μL
Primary or Secondary	Primary
Target Species	Human
Form	Antisera

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_023002
Gene Symbols	HAPLN4
Immunogen	HAPLN4 (NP_075378, 30 a.a. ∽ 134 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Gene ID (Entrez)	404037
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

For Research Use Only

Description