missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16101586

SLC12A6, Mouse, Polyclonal Antibody, Abnova™

Produktkod. 16101586
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
50 μL
Förpackningsstorlek:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16101586 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16101586 Leverantör Abnova Leverantörsnummer H00009990A01.50uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse polyclonal antibody raised against a partial recombinant SLC12A6.

This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy. [provided by RefSeq

Sequence: MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD

Specifikationer

Antigen SLC12A6
Användningsområden ELISA, Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Mouse polyclonal antibody raised against a partial recombinant SLC12A6.
Formulering 50% glycerol
Gen SLC12A6
Genaccessionsnr. NM_005135
Gene Alias ACCPN/DKFZp434D2135/KCC3/KCC3A/KCC3B
Gensymboler SLC12A6
Värd art Mouse
Immunogen SLC12A6 (NP_005126, 1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag.
Kvantitet 50 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 9990
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.