missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. MSH2 Antibody, Novus Biologicals™

MSH2 Antibody, Novus Biologicals™

Produktkod. 18610379 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
25 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18610379 100 μg
18607298 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18610379 Leverantör Novus Biologicals Leverantörsnummer NBP268845
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

MSH2 Polyclonal antibody specifically detects MSH2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen MSH2
Användningsområden Immunofluorescence
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias COCA1, DNA mismatch repair protein Msh2, FCC1, hMSH2, HNPCC, HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1), LCFS2, mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), MutS protein homolog 2
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
Reningsmetod Protein A purified
Kvantitet 100 μg
Regulatorisk status RUO
Forskningsdisciplin Breast Cancer, Cancer, Core ESC Like Genes, DNA Repair, Mismatch Repair, Stem Cell Markers, Tumor Suppressors
Primär eller sekundär Primary
Gen-ID (Entrez) 4436
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.