missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. Myeloperoxidase/MPO Antibody, Novus Biologicals™

Myeloperoxidase/MPO Antibody, Novus Biologicals™

Produktkod. 18687485 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
18687485 25 μL -
18125909 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18687485 Leverantör Novus Biologicals Leverantörsnummer NBP23892225ul

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

Myeloperoxidase/MPO Polyclonal specifically detects Myeloperoxidase/MPO in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen Myeloperoxidase/MPO
Användningsområden Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genaccessionsnr. P05164
Gene Alias EC 1.11.1, EC 1.11.1.7, myeloperoxidase
Gensymboler MPO
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
Reningsmetod Affinity Purified
Kvantitet 25 μL
Regulatorisk status RUO
Forskningsdisciplin Cell Biology, Immunology, Innate Immunity, Lipid and Metabolism
Primär eller sekundär Primary
Gen-ID (Entrez) 4353
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.