missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NDUFA1 (Human) Recombinant Protein
Human NDUFA1 full-length ORF ( AAH00266, 24 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00004694-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Specifications
| AAH00266 | |
| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NDUFA1 | |
| GST |
| 4694 | |
| Wheat germ expression system | |
| 10 μg | |
| CI-MWFE, MWFE, ZNF183 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |