missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NDUFA1 (Human) Recombinant Protein

Human NDUFA1 full-length ORF ( AAH00266, 24 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004694-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16118191

  • 4055.00 SEK / 10µg
Estimated Shipment: 07-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Specifications

Specifications

AAH00266
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NDUFA1
GST
4694
Wheat germ expression system
10 μg
CI-MWFE, MWFE, ZNF183
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers