missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NDUFAB1 (Human) Recombinant Protein

Human NDUFAB1 full-length ORF ( AAH58920, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004706-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138211

  • 3343.96 SEK / 10µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPYIDAEKLMCPQEIVDYIADKKDVYE
Specifications

Specifications

AAH58920
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NDUFAB1
GST
4706
Wheat germ expression system
10 μg
ACP, FASN2A, MGC65095, SDAP
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates