missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NDUFB8 (Human) Recombinant Protein

Human NDUFB8 full-length ORF ( AAH00466, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004714-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138231

  • 5030.41 SEK / 25µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Specifications

Specifications

AAH00466
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NDUFB8
GST
4714
Wheat germ expression system
25 μg
ASHI, CI-ASHI
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates