missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
NDUFB8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4665.00 SEK
Specifikationer
| Antigen | NDUFB8 |
|---|---|
| Utspädning | Western Blot 0.04-0.4 ug/ml |
| Användningsområden | Western Blot |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18323674
|
Novus Biologicals
NBP3-17898-25UL |
25 μg |
4665.00 SEK
25µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
NDUFB8 Polyclonal antibody specifically detects NDUFB8 in Human samples. It is validated for Western BlotSpecifikationer
| NDUFB8 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS, pH 7.2, 40% glycerol | |
| 4714 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CI-ASHImitochondrial, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa, NADH:ubiquinone oxidoreductase ASHI subunit, NADH-ubiquinone oxidoreductase ASHI subunit | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel