missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Neuronal Pentraxin 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5960.00 SEK
Specifikationer
| Antigen | Neuronal Pentraxin 2 |
|---|---|
| Utspädning | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Användningsområden | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18118158
|
Novus Biologicals
NBP2-38609 |
0.1 mL |
5960.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
Neuronal Pentraxin 2 Polyclonal specifically detects Neuronal Pentraxin 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| Neuronal Pentraxin 2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P47972 | |
| 4885 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLLDL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NARP, neuronal activity-regulated pentaxin, neuronal pentraxin IIapexin, neuronal pentraxin-2, NP2, NP-II | |
| NPTX2 | |
| IgG | |
| Affinity Purified |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel