missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 30509139

NFkB p105/p50 Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™

Produktkod. 30509139 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.1 mL
Förpackningsstorlek:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
30509139 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30509139 Leverantör Novus Biologicals Leverantörsnummer NBP338305AF488

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

NFkB p105/p50 Polyclonal antibody specifically detects NFkB p105/p50 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen NFkB p105/p50
Användningsområden ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Klassificering Polyclonal
Konjugera Alexa Fluor 488
Formulering 50mM Sodium Borate
Gene Alias DKFZp686C01211, DNA binding factor KBF1, DNA-binding factor KBF1, EBP-1, KBF1, NF-kappaB, NF-kappa-B, NF-kappabeta, NFKB-p105, NFKB-p50, nuclear factor kappa-B DNA binding subunit, nuclear factor NF-kappa-B p105 subunit, nuclear factor NF-kappa-B p50 subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151, p105, p50
Värd art Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 41-365 of human NFkB p105/p50 (NP_001158884.1).,, Sequence:, LAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSD
Reningsmetod Affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Apoptosis, Cancer, Cell Biology, Diabetes Research, DNA Repair, Neurodegeneration, Neuroscience, Nucleotide Excision Repair, Phospho Specific, Signal Transduction, Transcription Factors and Regulators
Primär eller sekundär Primary
Gen-ID (Entrez) 4790
Målarter Human, Mouse, Rat
Innehåll och lagring Store at 4°C in the dark.
Produkttyp Antibody
Form Purified
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.