missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NME1 (Human) Recombinant Protein
Human NME1 full-length ORF ( AAH00293, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | AAH00293 |
|---|---|
| Gene ID (Entrez) | 4830 |
| Name | non-metastatic cells 1, protein (NM23A) expressed in |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16128401
|
Abnova™
H00004830-P01.10UG |
10 μg |
4515.00 SEK
10µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16138401
|
Abnova™
H00004830-P01.25UG |
25 μg |
6845.00 SEK
25µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Specifications
| AAH00293 | |
| non-metastatic cells 1, protein (NM23A) expressed in | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 4830 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NME1 | |
| GST |