missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Noggin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5655.00 SEK
Specifikationer
| Antigen | Noggin |
|---|---|
| Utspädning | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Användningsområden | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18183613
|
Novus Biologicals
NBP2-34141 |
0.1 mL |
5655.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
Noggin Polyclonal specifically detects Noggin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| Noggin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q13253 | |
| 9241 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience, Stem Cell Markers, Stem Cell Signaling Pathway | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| noggin, SYM1, symphalangism 1 (proximal), synostoses (multiple) syndrome 1, SYNS1 | |
| NOG | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel