missing translation for 'onlineSavingsMsg'
Learn More

NOTCH2NL Recombinant Protein, Abnova

Recombinant protein for NOTCH2NL (human) gene

Brand:  Abnova H00388677-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16180494

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Human NOTCH2NL full-length ORF ( AAH19835, 1 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal
  • Theoretical molecular weight: 51.7kDa
  • Preparation: in vitrowheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQY CDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Specifications

Specifications

AAH19835
Solution
388677
NOTCH2NL (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NOTCH2NL
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
51.7
8
Glutathione Sepharose 4 Fast Flow
10 ug
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
N2N
NOTCH2NL
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates