missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NT5E (Human) Recombinant Protein

Human NT5E full-length ORF ( AAH15940.1, 28 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004907-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16118511

  • 6150.00 SEK / 25µg
Estimated Shipment: 11-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
Specifications

Specifications

AAH15940.1
5'-nucleotidase, ecto (CD73)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NT5E
GST
4907
Wheat germ expression system
25 μg
CD73, E5NT, NT, NT5, NTE, eN, eNT
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers