missing translation for 'onlineSavingsMsg'
Läs mer

NXF1 Antibody, Novus Biologicals™

Produktkod. 30230304 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30230304 100 μL
30229320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30230304 Leverantör Novus Biologicals Leverantörsnummer NBP338212100ul

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Rabbit Polyclonal Antibody

NXF1 Polyclonal antibody specifically detects NXF1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen NXF1
Användningsområden ELISA, Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500 - 1:1000, ELISA
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein
Värd art Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2).,, Sequence:, ILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
Reningsmetod Affinity purified
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 10482
Målarter Human, Mouse, Rat
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.