missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. Odf1 Antibody - Azide and BSA Free, R&D Systems™

Odf1 Antibody - Azide and BSA Free, R&D Systems™

Produktkod. 18606580 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.02 mL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18606580 0.1 mL 0.1ml
18659650 0.02 mL -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18606580 Leverantör Novus Biologicals Leverantörsnummer NBP2936010.1ml
 Begränsad artikel
Beräknad leverans: 03-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Odf1 Polyclonal specifically detects Odf1 in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen Odf1
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias cancer/testis antigen 133, CT133, HSPB10, MGC129928, MGC129929, ODF, ODF2, ODF27, ODFP, ODFPG, ODFPGA, ODFPGB, outer dense fiber of sperm tails 1, outer dense fiber of sperm tails, 27-kD, outer dense fiber protein 1, outer dense fibre of sperm tails 1, RT7, SODF
Värd art Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2). LYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
Reningsmetod Affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 4956
Målarter Human, Mouse, Rat
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.