missing translation for 'onlineSavingsMsg'
Learn More

OIT3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09657-100UL

Product Code. 18321265

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

OIT3 Polyclonal specifically detects OIT3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	OIT3
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	Liver-specific zona pellucida domain-containing protein, liver-specific ZP domain-containing protein, LZPFLJ39116, oncoprotein induced transcript 3, oncoprotein-induced transcript 3 protein
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human OIT3 (NP_689848). Peptide sequence CRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIRIDWE
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	170392
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description