missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
OMA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
Brand: Novus Biologicals NBP1-56970-100UL
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
OMA1 Polyclonal specifically detects OMA1 in Human samples. It is validated for Western Blot.
Specifikationer
| OMA1 | |
| Polyclonal | |
| Western Blot 0.2-1 μ/mL | |
| Q96E52 | |
| OMA1 | |
| Synthetic peptides corresponding to OMA1 (OMA1 homolog, zinc metallopeptidase (S. cerevisiae)) The peptide sequence was selected from the middle region of OMA1. Peptide sequence WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA. | |
| Primary | |
| Human, Fish | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% sodium azide | |
| 2010001O09Rik, DAB1, EC 3.4.24.-, metalloprotease related protein 1, Metalloprotease-related protein 1, MPRP1, MPRP-1mitochondrial, OMA1 homolog, zinc metallopeptidase (S. cerevisiae), overlapping activity with M-AAA protease, YKR087C, ZMPOMA1 | |
| Rabbit | |
| 100 μL | |
| 115209 | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering