missing translation for 'onlineSavingsMsg'
Learn More

OR10P1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09857-100UL

Product Code. 18322585

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

OR10P1 Polyclonal specifically detects OR10P1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	OR10P1
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	olfactory receptor 10P1, Olfactory receptor 10P2, Olfactory receptor 10P3, Olfactory receptor OR12-7, olfactory receptor, family 10, subfamily P, member 1, olfactory receptor, family 10, subfamily P, member 1 pseudogene, olfactory receptor, family 10, subfamily P, member 2 pseudogene, olfactory receptor, family 10, subfamily P, member 3 pseudogene, OR10P1P, OR10P2P, OR10P3P, OR12-7, OST701, seven transmembrane helix receptor
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10P1 (NP_996782). Peptide sequence LFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	121130
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description