missing translation for 'onlineSavingsMsg'
Learn More

Print

OR8U8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

4369.22 SEK

Specifications

Antigen	OR8U8
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18332145 View Documents Promotion Details missing translation for 'viewProductCertificates'	Bio-Techne NBP3-09834-100UL	100 μg	4369.22 SEK 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Description

OR8U8 Polyclonal specifically detects OR8U8 in Human samples. It is validated for Western Blot.

Specifications

Specifications

Antigen	OR8U8
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	olfactory receptor 8U8, olfactory receptor, family 8, subfamily U, member 8
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8U8 (NP_001013374). Peptide sequence SLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLK
Purification Method	Affinity purified

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	504189
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Back to Top