missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR8U8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4369.22 SEK
Specifications
Antigen | OR8U8 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
OR8U8 Polyclonal specifically detects OR8U8 in Human samples. It is validated for Western Blot.Specifications
OR8U8 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
olfactory receptor 8U8, olfactory receptor, family 8, subfamily U, member 8 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8U8 (NP_001013374). Peptide sequence SLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLK | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
504189 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |