missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
ORF1 FL49 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13898
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
ORF1 FL49 Polyclonal specifically detects ORF1 FL49 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| ORF1 FL49 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| chromosome 5 open reading frame 32, hypothetical protein LOC84418, ORF1-FL49, putative nuclear protein ORF1-FL49 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 84418 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CYSTM1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering