missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Beskrivning
OSGEP Polyclonal specifically detects OSGEP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
Specifikationer
| Antigen | OSGEP |
| Användningsområden | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Utspädning | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulering | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | EC 3.4.24.57, GCPL1FLJ20411, hOSGEP, KAE1, OSGEP1, O-sialoglycoprotein endopeptidase, probable O-sialoglycoprotein endopeptidase, PRSMG1, t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEP |
| Gensymboler | OSGEP |
| Värd art | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGP |
| Visa mer |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?