missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. p14ARF/CDKN2A Antibody, R&D Systems™

p14ARF/CDKN2A Antibody, R&D Systems™

Produktkod. 18621319 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18621319 25 μg
18635268 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18621319 Leverantör Novus Biologicals Leverantörsnummer NBP30552125ul
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

p14ARF/CDKN2A Polyclonal specifically detects p14ARF/CDKN2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen p14ARF/CDKN2A
Användningsområden Immunocytochemistry/Immunofluorescence
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulering PBS, pH 7.2, containing 40% glycerol
Gene Alias ARF, CDK4 inhibitor p16-INK4, CDK4IP14ARF, CDKN2, cell cycle negative regulator beta, CMM2P16-INK4A, Cyclin-dependent kinase 4 inhibitor A, cyclin-dependent kinase inhibitor 2A, cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), INK4, INK4A, MLMP16INK4, MTS-1, MTS1P14, Multiple tumor suppressor 1, p14, p14ARF, p16, p16-INK4, p16INK4a, p16-INK4a, P19, p19ARF, TP16
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
Reningsmetod Affinity purified
Kvantitet 25 μg
Regulatorisk status RUO
Forskningsdisciplin ABC Transporters, Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, Hypoxia, MAP Kinase Signaling, Neuroscience, p53 Pathway, Transcription Factors and Regulators, Tumor Suppressors
Primär eller sekundär Primary
Gen-ID (Entrez) 1029
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.