missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Paladin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-11001-100UL
This item is not returnable.
View return policy
Description
Paladin Polyclonal specifically detects Paladin in Human samples. It is validated for Western Blot.Specifications
| Paladin | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| KIAA1274, paladin, PALD, palladin | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human Paladin (NP_055246). Peptide sequence GHRVKKEVDAALDTVSETMTPMHYHLREIIICTYRQAKAAKEAQEMRRLQ | |
| 100 μg | |
| Protein Phosphatase | |
| 27143 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |