missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
PAPSS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
4690.00 SEK
Specifikationer
| Antigen | PAPSS2 |
|---|---|
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Värd art | Rabbit |
| Regulatorisk status | RUO |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18230904
|
Novus Biologicals
NBP1-55135 |
100 μL |
4690.00 SEK
100µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
PAPSS2 Polyclonal specifically detects PAPSS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| PAPSS2 | |
| Unconjugated | |
| RUO | |
| O95340-2 | |
| 9060 | |
| Synthetic peptides corresponding to PAPSS2(3'-phosphoadenosine 5'-phosphosulfate synthase 2) The peptide sequence was selected from the C terminal of PAPSS2. Peptide sequence PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2 | |
| PAPSS2 | |
| IgG | |
| 70 kDa |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel