missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAR4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17410-100UL
This item is not returnable.
View return policy
Description
PAR4 Polyclonal antibody specifically detects PAR4 in Human samples. It is validated for ImmunofluorescenceSpecifications
| PAR4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| proteinase-activated receptor 4, coagulation factor II (thrombin) receptor-like 3, PAR4 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ | |
| 100 μg | |
| GPCR | |
| 9002 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |