missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. PCDHA10 Antibody - Azide and BSA Free, R&D Systems™

PCDHA10 Antibody - Azide and BSA Free, R&D Systems™

Produktkod. 18603770 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.02 mL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18603770 0.1 mL 0.1ml
18608421 0.02 mL -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18603770 Leverantör Novus Biologicals Leverantörsnummer NBP2931550.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternativa produkter

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PCDHA10 Polyclonal antibody specifically detects PCDHA10 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen PCDHA10
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias CNR8, CNRN8, CNRS8, CRNR8, KIAA0345-like 4, ortholog to mouse CNR8, PCDH-alpha-10, PCDH-ALPHA10, protocadherin alpha 10, protocadherin alpha-10
Värd art Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human PCDHA10 (NP_114066.1). PRFSVTEQKLSIPESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPVLVLRKLLDREENPQLKLL
Reningsmetod Affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Neuroscience, Signal Transduction
Primär eller sekundär Primary
Gen-ID (Entrez) 56139
Målarter Human
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.