missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. PDCL3 Antibody, R&D Systems™

PDCL3 Antibody, R&D Systems™

Produktkod. 18257485 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.1 mL
25ul
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18257485 0.1 mL 0.1ml
18409490 25ul -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18257485 Leverantör Novus Biologicals Leverantörsnummer NBP180627
  • ONLINE EXCLUSIVE PRICE
    6067.01 SEK
    5156.55 SEK / 0.1ml
    Save 910.46 SEK
    15% Av
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PDCL3 Polyclonal specifically detects PDCL3 in Human samples. It is validated for ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen PDCL3
Användningsområden ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genaccessionsnr. Q9H2J4
Gene Alias HTPHLP, IAP-associated factor VIAF1, MGC3062, PHLP3, phosducin-like 3, phosducin-like protein 3, PhPL3, VIAF, VIAF-1, VIAF1PHLP2A, Viral IAP-associated factor 1
Gensymboler PDCL3
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
Reningsmetod Affinity Purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Apoptosis
Primär eller sekundär Primary
Gen-ID (Entrez) 79031
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.