missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

Produktkod. 18604792 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.02 mL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18604792 0.02 mL -
18691622 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18604792 Leverantör Novus Biologicals Leverantörsnummer NBP2942380.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternativa produkter

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PGC-1 beta Polyclonal antibody specifically detects PGC-1 beta in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen PGC-1 beta
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias DKFZp686C1790, ERRL1, PERCFLJ14284, peroxisome proliferator-activated receptor gamma, coactivator 1 beta, PGC1, PGC1Bgamma, coactivator 1, beta, PPARGC1
Värd art Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 850-950 of human PGC1 beta (NP_001166170.1). SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSL
Reningsmetod Affinity purified
Kvantitet 0.02 mL
Regulatorisk status RUO
Forskningsdisciplin Breast Cancer, Cancer, Chromatin Research, Diabetes Research, Hypoxia, Lipid and Metabolism, Mitochondrial Markers, Neuroscience, Signal Transduction
Primär eller sekundär Primary
Gen-ID (Entrez) 133522
Målarter Human, Mouse
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.