missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PI3 (Human) Recombinant Protein

Human PI3 full-length ORF ( AAH10952, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005266-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139061

  • 4055.00 SEK / 10µg
Estimated Shipment: 30-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Specifications

Specifications

AAH10952
peptidase inhibitor 3, skin-derived
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PI3
GST
5266
Wheat germ expression system
10 μg
ESI, MGC13613, SKALP, WAP3, WFDC14, cementoin
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers