Learn More
Abnova™ PILRB Recombinant Protein
Human PILRB full-length ORF ( AAH50547, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00029990-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7. This particular gene encodes the non-ITIM-bearing member of the receptor pair, which has a truncated cytoplasmic tail relative to its ITIM-bearing partner and functions in the activating role. Alternative splicing has been observed at this locus and three variants, encoding two distinct isoforms, are described. Additional transcript variants have been identified but their full-length nature has not been determined. (provided by RefSeq)
- Molecular weight: 50.71kDa
- Preparation method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
- Quality Control Testing:12.5% SDS-PAGE stained with Coomassie Blue
Best use within three months from the date of receipt of this protein
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH50547 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
51.1 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MGRPLLLPLLLLLQPPAFLQPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALAVAVLKTVILGLLCLLLLWWRRRKGSRAPSSDF | |
FDFACT1/FDFACT2 | |
PILRB | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
29990 | |
PILRB (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PILRB | |
Human | |
Recombinant | |
Solution |