missing translation for 'onlineSavingsMsg'
Learn More

PIRT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP1-90968

Product Code. 18323470

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PIRT Polyclonal specifically detects PIRT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	PIRT
Classification	Polyclonal
Dilution	Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias	phosphoinositide-interacting protein, phosphoinositide-interacting regulator of transient receptor potential channels, phosphoinositide-interacting regulator of TRPV1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	644139
Target Species	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	PIRT
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:ETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYR
Quantity	0.1 mL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

For Research Use Only

Description